# Recombinant Human IFN gamma Protein

**Cod produs:** A330762 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Human IFN gamma Protein este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A330762, pentru ținta IFN gamma. Se livrează în mărimile 20µg, 50µg și 100µg, la prețuri între 1.197,90 și 2.096,33 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | IFN gamma |
| Conjugate | Unconjugated |
| Formulation | Lyophilized from Phosphate Buffered Saline, pH 7.4 (0.22µm filter sterilized). |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | > 95% (by SDS-PAGE). |
| Expression system | Escherichia coli |
| Nature | Recombinant |
| Protein species | Human |
| Endotoxin level | <0.1 EU/µg of the protein by LAL method. |
| Storage | Shipped at 4°C. Lyophilized: Store at -20°C to -80°C up to 1 year from the date of receipt. Reconstituted: Aliquot and store at -20°C for 3 months or 2-8°C for up to 1 week. Avoid freeze/thaw cycles. |
| Secvență | QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 20µg | A330762-20 · 1.197,90 lei |
| 50µg | A330762-50 · 1.563,93 lei |
| 100µg | A330762-100 · 2.096,33 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/330/A330762.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-human-ifn-gamma-protein/ · actualizat 9 septembrie 2026