# Recombinant Human Iba1 Protein (N-terminal His Tag)

**Cod produs:** A61801 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Human Iba1 Protein (N-terminal His Tag) este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A61801, pentru ținta Iba1. Se livrează în mărimile 2µg, 10µg și 1mg, la prețuri între 1.730,30 și 41.460,65 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Iba1 |
| Applications | SDS-PAGE |
| Formulation | Lyophilized from 20 mM Tris Buffer, pH 7.5, with 50 mM Sodium Chloride. |
| Product form | Lyophilized |
| Concentration | 500 µg/ml |
| Purity | >90% as determined by SDS-PAGE. |
| Expression system | Escherichia coli |
| Nature | Recombinant |
| Protein species | Human |
| Reconstitution | Reconstitute with deionized water and let the lyophilized pellet dissolve completely. |
| Protein Length | Full length protein. |
| Storage | Shipped at ambient temperature. Lyophilized: Long term store at -20°C. Reconstituted and aliquoted: Short term (2 weeks) store at 4°C. Long term (2 years) stable at -20°. Avoid freeze/thaw cycles. |
| Secvență | MKHHHHHHASQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAKKAISELP |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 2µg | A61801-2 · 1.730,30 lei |
| 10µg | A61801-10 · 2.329,25 lei |
| 1mg | A61801-1 · 41.460,65 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/61/A61801.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-human-iba1-protein-n-terminal-his-tag/ · actualizat 9 septembrie 2026