# Recombinant Human Histone H2A Protein

**Cod produs:** A330740 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Human Histone H2A Protein este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A330740, pentru ținta Histone H2A. Se livrează în mărimea 100µg, la prețul de 5.091,08 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Histone H2A |
| Conjugate | Unconjugated |
| Formulation | Lyophilized from Phosphate Buffered Saline, pH 7.4 (0.22µm filter sterilized). |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | > 95% (by SDS-PAGE). |
| Expression system | Escherichia coli |
| Nature | Recombinant |
| Protein species | Human |
| Endotoxin level | <1 EU/µg of the protein by LAL method. |
| Storage | Shipped at 4°C. Lyophilized: Store at -20°C to -80°C up to 1 year from the date of receipt. Reconstituted: Aliquot and store at -20°C for 3 months or 2-8°C for up to 1 week. Avoid freeze/thaw cycles. |
| Secvență | SGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µg | A330740-100 · 5.091,08 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/330/A330740.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-human-histone-h2a-protein/ · actualizat 9 septembrie 2026
