# Recombinant Human Histone H1 Protein (N-terminal His Tag)

**Cod produs:** A330739 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Human Histone H1 Protein (N-terminal His Tag) este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A330739, pentru ținta Histone H1. Se livrează în mărimea 100µg, la prețul de 6.388,80 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Histone H1 |
| Conjugate | Unconjugated |
| Formulation | Lyophilized from 50mM Tris, pH 8.5, with 600mM NaCl and 1mM DTT (0.22µm filter sterilized). |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | >92% (by SDS-PAGE). |
| Expression system | Escherichia coli |
| Nature | Recombinant |
| Protein species | Human |
| Storage | Shipped at 4°C. Lyophilized: Store at -20°C to -80°C up to 1 year from the date of receipt. Reconstituted: Aliquot and store at -20°C for 3 months or 2-8°C for up to 1 week. Avoid freeze/thaw cycles. |
| Secvență | MTENSTSAPAAKPKRAKASKKSTDHPKYSDMIVAAIQAEKNRAGSSRQSIQKYIKSHYKVGENADSQIKLSIKRLVTTGVLKQTKGVGASGSFRLAKSDEPKKSVAFKKTKKEIKKVATPKKASKPKKAASKAPTKKPKATPVKKAKKKLAATPKKAKKPKTVKAKPVKASKPKKAKPVKPKAKSSAKRAGKKK |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µg | A330739-100 · 6.388,80 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/330/A330739.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-human-histone-h1-protein-n-terminal-his-tag/ · actualizat 9 septembrie 2026