# Recombinant Human HCG beta Protein (C-terminal His Tag)

**Cod produs:** A330730 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Human HCG beta Protein (C-terminal His Tag) este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A330730, pentru ținta HCG beta. Se livrează în mărimea 50µg, la prețul de 5.324,00 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | HCG beta |
| Conjugate | Unconjugated |
| Formulation | Lyophilized from 20mM PB, pH 7.4, with 150mM NaCl (0.22µm filter sterilized). |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | >95% (by SEC-HPLC). |
| Expression system | HEK293 cells |
| Nature | Recombinant |
| Protein species | Human |
| Endotoxin level | <1 EU/µg. |
| Storage | Shipped at 4°C. Lyophilized: Store at -20°C to -80°C up to 1 year from the date of receipt. Reconstituted: Aliquot and store at -20°C for 3 months or 2-8°C for up to 1 week. Avoid freeze/thaw cycles. |
| Secvență | SKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 50µg | A330730-50 · 5.324,00 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/330/A330730.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-human-hcg-beta-protein-c-terminal-his-tag/ · actualizat 9 septembrie 2026