# Recombinant Human GNLY/Granulysin Protein (C + N-terminal His Tag)

**Cod produs:** A60895 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Human GNLY/Granulysin Protein (C + N-terminal His Tag) este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A60895, pentru ținta GNLY/Granulysin. Se livrează în mărimile 2µg, 10µg și 1mg, la prețuri între 1.730,30 și 36.203,20 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | GNLY/Granulysin |
| Applications | SDS-PAGE |
| Formulation | Lyophilized without additives. |
| Product form | Lyophilized |
| Concentration | 1 mg/ml |
| Purity | >95% as determined by SDS-PAGE. |
| Expression system | Escherichia coli |
| Nature | Recombinant |
| Protein species | Human |
| Reconstitution | Reconstitute with 18 MO-cm water, to no less than 0.1 mg/ml, which can then be further diluted to other aqueous solutions. |
| Protein Length | Full length protein. |
| Secvență | MGSSHHHHHHSSGLVPRGSHMMEGLVFSRLSPEYYDLARAHLRDEEKSCPCLAQEGPQGDLLTKTQELGRDYRTCLTIVQKLKKMVDKPTQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVTQGLVAGETAQQICEDLRLCIPSTGPLGSHHHHHH |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 2µg | A60895-2 · 1.730,30 lei |
| 10µg | A60895-10 · 2.329,25 lei |
| 1mg | A60895-1 · 36.203,20 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/60/A60895.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-human-gnly-granulysin-protein-c-n-terminal-his-tag/ · actualizat 9 septembrie 2026
