# Recombinant Human GMFB Protein

**Cod produs:** A63583 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Human GMFB Protein este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A63583, pentru ținta GMFB. Se livrează în mărimile 2µg, 10µg și 1mg, la prețuri între 1.730,30 și 41.460,65 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | GMFB |
| Applications | SDS-PAGE |
| Formulation | Lyophilized from 20 mM Phosphate Buffered Saline, pH 7.4, with 130 mM Sodium Chloride. |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | >98% as determined by RP-HPLC and SDS-PAGE. |
| Expression system | Escherichia coli |
| Nature | Recombinant |
| Protein species | Human |
| Reconstitution | Reconstitute with 18 MO-cm water, to no less than 0.1 mg/ml, which can then be further diluted to other aqueous solutions. |
| Protein Length | Full length protein. |
| Secvență | SESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQT AELTKVFEIRNTEDLTEEWLREKLGFFH |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 2µg | A63583-2 · 1.730,30 lei |
| 10µg | A63583-10 · 2.329,25 lei |
| 1mg | A63583-1 · 41.460,65 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/63/A63583.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-human-gmfb-protein/ · actualizat 9 septembrie 2026