# Recombinant Human Galectin 7 Protein

**Cod produs:** A63273 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Human Galectin 7 Protein este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A63273, pentru ținta Galectin 7. Se livrează în mărimile 2µg, 10µg și 1mg, la prețuri între 1.730,30 și 45.586,75 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Galectin 7 |
| Applications | SDS-PAGE |
| Formulation | Lyophilized from 20 mM Tris Buffer, pH 8, with 150 mM Sodium Chloride, 5% Trehalose, and 1 mM EDTA. |
| Product form | Lyophilized |
| Concentration | 1 mg/ml |
| Purity | >95% as determined by SDS-PAGE. |
| Expression system | Escherichia coli |
| Nature | Recombinant |
| Protein species | Human |
| Reconstitution | Reconstitute with distilled water, to no less than 0.1 mg/ml, which can then be further diluted to other aqueous solutions. |
| Protein Length | Full length protein. |
| Secvență | MSNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 2µg | A63273-2 · 1.730,30 lei |
| 10µg | A63273-10 · 2.329,25 lei |
| 1mg | A63273-1 · 45.586,75 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/63/A63273.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-human-galectin-7-protein/ · actualizat 9 septembrie 2026