# Recombinant Human FNDC5 Protein

**Cod produs:** A58890 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Human FNDC5 Protein este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A58890, pentru ținta FNDC5. Se livrează în mărimile 2µg, 10µg și 1mg, la prețuri între 1.730,30 și 45.586,75 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | FNDC5 |
| Applications | SDS-PAGE |
| Formulation | Lyophilized from Phosphate Buffered Saline. |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | >98% as determined by SDS-PAGE. |
| Expression system | Yeast |
| Nature | Recombinant |
| Protein species | Human |
| Reconstitution | Reconstitute with 18 MO-cm water, to no less than 0.1 mg/ml, which can then be further diluted to other aqueous solutions. |
| Protein Length | Protein fragment |
| Secvență | SPSAPVNVTVRHLKANSAVVSWDVLEDEVVIGFAISQQKKD VRMLRFIQEVNTTTRSCALW DLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMAS KNKDEVTMKE |
| Activitate biologică | The biological activity of recombinant human irisin was measured by the ability to induce UCP-1 expression of adipocytes. The specific activity is 10 ng/ml. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 2µg | A58890-2 · 1.730,30 lei |
| 10µg | A58890-10 · 2.329,25 lei |
| 1mg | A58890-1 · 45.586,75 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/58/A58890.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-human-fndc5-protein/ · actualizat 9 septembrie 2026