# Recombinant Human FLT3L Protein (C-terminal His Tag)

**Cod produs:** A330663 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Human FLT3L Protein (C-terminal His Tag) este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A330663, pentru ținta FLT3L. Se livrează în mărimile 20µg și 50µg, la prețuri între 1.896,68 și 2.662,00 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | FLT3L |
| Conjugate | Unconjugated |
| Formulation | Lyophilized from Phosphate Buffered Saline, pH 7.4 (0.22µm filter sterilized). |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | > 95% (by SDS-PAGE). |
| Expression system | HEK293 cells |
| Nature | Recombinant |
| Protein species | Human |
| Endotoxin level | <0.1 EU/µg of the protein by LAL method. |
| Storage | Shipped at 4°C. Lyophilized: Store at -20°C to -80°C up to 1 year from the date of receipt. Reconstituted: Aliquot and store at -20°C for 3 months or 2-8°C for up to 1 week. Avoid freeze/thaw cycles. |
| Secvență | TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTAPQPP |
| Activitate biologică | Immobilized Recombinant Human Flt3 ligand (2 µg/mL) bind Recombinant Human Flt-3 in a functional ELISA with a linear range of 0.128-3.97 ng/mL. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 20µg | A330663-20 · 1.896,68 lei |
| 50µg | A330663-50 · 2.662,00 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/330/A330663.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-human-flt3l-protein-c-terminal-his-tag/ · actualizat 9 septembrie 2026
