# Recombinant Human FKBP12 Protein (N-terminal His Tag)

**Cod produs:** A62126 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Human FKBP12 Protein (N-terminal His Tag) este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A62126, pentru ținta FKBP12. Se livrează în mărimile 2µg, 10µg și 100µg, la prețuri între 1.963,23 și 4.891,43 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | FKBP12 |
| Applications | SDS-PAGE |
| Formulation | Supplied in 50 mM HEPES Buffer, pH 8, with 150 mM Sodium Chloride, 500 µM EDTA, and 1 mM Sodium Azide. |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purity | >99% as determined by SDS-PAGE. |
| Expression system | Escherichia coli |
| Nature | Recombinant |
| Protein species | Human |
| Storage | Shipped at 4°C. Short term (2-4 weeks) store at 4°C. Long term store at -20°C, it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid freeze/thaw cycles. |
| Secvență | MAHHHHHHVMGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 2µg | A62126-2 · 1.963,23 lei |
| 10µg | A62126-10 · 2.628,73 lei |
| 100µg | A62126-100 · 4.891,43 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/62/A62126.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-human-fkbp12-protein-n-terminal-his-tag/ · actualizat 9 septembrie 2026