# Recombinant Human Fibronectin Protein (C-terminal His Tag)

**Cod produs:** A330658 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Human Fibronectin Protein (C-terminal His Tag) este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A330658, pentru ținta Fibronectin. Se livrează în mărimile 20µg și 50µg, la prețuri între 1.197,90 și 1.730,30 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Fibronectin |
| Conjugate | Unconjugated |
| Formulation | Lyophilized from Phosphate Buffered Saline, pH 7.4 (0.22µm filter sterilized). |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | > 90% (by SDS-PAGE) |
| Expression system | HEK293 cells |
| Nature | Recombinant |
| Protein species | Human |
| Storage | Shipped at 4°C. Lyophilized: Store at -20°C to -80°C up to 1 year from the date of receipt. Reconstituted: Aliquot and store at -20°C for 3 months or 2-8°C for up to 1 week. Avoid freeze/thaw cycles. |
| Secvență | NIDRPKGLAFTDVDVDSIKIAWESPQGQVSRYRVTYSSPEDGIHELFPAPDGEEDTAELQGLRPGSEYTVSVVALHDDMESQPLIGTQST |
| Activitate biologică | Immobilized protein supports the adhesion of NIH-3T3 mouse embryonic fibroblast cells (2.5µg/mL and 100 µL/well): approximately 30%-40% cells adhere specifically after 30 minutes at 37?. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 20µg | A330658-20 · 1.197,90 lei |
| 50µg | A330658-50 · 1.730,30 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/330/A330658.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-human-fibronectin-protein-c-terminal-his-tag-2/ · actualizat 9 septembrie 2026