# Recombinant Human FHIT Protein (GST Tag)

**Cod produs:** A58578 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Human FHIT Protein (GST Tag) este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A58578, pentru ținta FHIT. Se livrează în mărimile 2µg, 5µg și 10µg, la prețuri între 3.194,40 și 6.222,43 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | FHIT |
| Applications | ELISA, Inhibition Assays, WB |
| Formulation | Supplied in 50 mM Tris Acetate Buffer, pH 7.5, with 1 mM EDTA and 20% Glycerol. |
| Product form | Liquid |
| Concentration | Lot Specific |
| Expression system | Escherichia coli |
| Nature | Recombinant |
| Protein species | Human |
| Protein Length | Full length protein. |
| Storage | Shipped at 4°C. Store at -20°C to -80°C, stable for 12 months. Avoid freeze/thaw cycles. |
| Secvență | MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWRSEEEMAAEAAALRVYFQ |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 2µg | A58578-2 · 3.194,40 lei |
| 5µg | A58578-5 · 4.092,83 lei |
| 10µg | A58578-10 · 6.222,43 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/58/A58578.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-human-fhit-protein-gst-tag/ · actualizat 9 septembrie 2026