# Recombinant Human FGF2 Protein

**Cod produs:** A330626 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Human FGF2 Protein este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A330626, pentru ținta FGF2. Se livrează în mărimile 20µg, 50µg și 100µg, la prețuri între 1.197,90 și 2.096,33 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | FGF2 |
| Conjugate | Unconjugated |
| Formulation | Lyophilized from 20mM Tris, pH 7.5, with 150mM Nacl (0.22µm filter sterilized). |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | > 95% (by SDS-PAGE). |
| Expression system | Escherichia coli |
| Nature | Recombinant |
| Protein species | Human |
| Endotoxin level | <1 EU/µg of the protein by LAL method. |
| Storage | Shipped at 4°C. Lyophilized: Store at -20°C to -80°C up to 1 year from the date of receipt. Reconstituted: Aliquot and store at -20°C for 3 months or 2-8°C for up to 1 week. Avoid freeze/thaw cycles. |
| Secvență | PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 20µg | A330626-20 · 1.197,90 lei |
| 50µg | A330626-50 · 1.563,93 lei |
| 100µg | A330626-100 · 2.096,33 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/330/A330626.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-human-fgf2-protein-5/ · actualizat 9 septembrie 2026
