# Recombinant Human FGF12 Protein (C-terminal His Tag)

**Cod produs:** A330623 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Human FGF12 Protein (C-terminal His Tag) este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A330623, pentru ținta FGF12. Se livrează în mărimile 10µg și 20µg, la prețuri între 1.464,10 și 1.896,68 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | FGF12 |
| Conjugate | Unconjugated |
| Formulation | Lyophilized from Phosphate Buffered Saline, pH 7.4, with 1mM DTT and 300mM NaCl (0.22µm filter sterilized). |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | >97% (by SDS-PAGE). |
| Expression system | Escherichia coli |
| Nature | Recombinant |
| Protein species | Human |
| Endotoxin level | <1 EU/µg of the protein by LAL method. |
| Storage | Shipped at 4°C. Lyophilized: Store at -20°C to -80°C up to 1 year from the date of receipt. Reconstituted: Aliquot and store at -20°C for 3 months or 2-8°C for up to 1 week. Avoid freeze/thaw cycles. |
| Secvență | MESKEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYREPSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST |
| Activitate biologică | Immobilized recombinant human FGFR4 (5 µg/mL) bind recombinant human FGF12 in a functional ELISA with a linear range of 35-100 ng/mL. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 10µg | A330623-10 · 1.464,10 lei |
| 20µg | A330623-20 · 1.896,68 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/330/A330623.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-human-fgf12-protein-c-terminal-his-tag/ · actualizat 9 septembrie 2026