# Recombinant Human Fas Protein (C-terminal His Tag)

**Cod produs:** A58602 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Human Fas Protein (C-terminal His Tag) este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A58602, pentru ținta FAS. Se livrează în mărimile 5µg, 20µg și 1mg, la prețuri între 1.963,23 și 27.052,58 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | FAS |
| Applications | SDS-PAGE |
| Formulation | Supplied at pH 8 with 10 mM Sodium Phosphate. |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purity | >95% as determined by RP-HPLC and SDS-PAGE. |
| Expression system | Escherichia coli |
| Nature | Recombinant |
| Protein species | Human |
| Protein Length | Protein fragment |
| Storage | Shipped at 4°C. Short term (5 days) store at 10°C. Long term store below -18°C. Avoid freeze/thaw cycles. |
| Secvență | CTLTSNTKCKEEGSRSNLGWLCLLLLPIPLIVWVKRKEVQKTCRKHRKENQGSHESPTLNPETVAINLSDVDLSKYITTIAGVMTLSQVKGFVRKNGVNEAKIDEIKNDNVQDTAEQKVQLLRNWHQLHGKKEAYDTLIKDLKKANLCTLAEKIQTIILKDITSDSENSNFRNEIQSLV |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 5µg | A58602-5 · 1.963,23 lei |
| 20µg | A58602-20 · 2.628,73 lei |
| 1mg | A58602-1 · 27.052,58 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/58/A58602.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-human-fas-protein-c-terminal-his-tag/ · actualizat 9 septembrie 2026