# Recombinant Human Fas Ligand Protein (N-terminal His Tag)

**Cod produs:** A61455 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Human Fas Ligand Protein (N-terminal His Tag) este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A61455, pentru ținta Fas Ligand. Se livrează în mărimile 2µg, 10µg și 1mg, la prețuri între 1.963,23 și 33.873,95 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Fas Ligand |
| Applications | SDS-PAGE |
| Formulation | Supplied in Phosphate Buffered Saline. |
| Product form | Liquid |
| Concentration | 0.6mg/ml |
| Purity | >95% as determined by SEC-HPLC and SDS-PAGE. |
| Expression system | HEK293 cells |
| Nature | Recombinant |
| Protein species | Human |
| Protein Length | Protein fragment |
| Storage | Shipped at 4°C. Short term (1 week) store at 4°C. Long term store below -18°C. Avoid freeze/thaw cycles. |
| Secvență | PSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL |
| Activitate biologică | ED50: <10 ng/ml, as determined by its ability to induce cytotoxicity in Jurkat cells in the absence of any cross-linking, corresponding to a specific activity of 1x105 U/mg. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 2µg | A61455-2 · 1.963,23 lei |
| 10µg | A61455-10 · 2.628,73 lei |
| 1mg | A61455-1 · 33.873,95 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/61/A61455.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-human-fas-ligand-protein-n-terminal-his-tag/ · actualizat 9 septembrie 2026