# Recombinant Human FABP5 Protein

**Cod produs:** A60485 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Human FABP5 Protein este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A60485, pentru ținta FABP5. Se livrează în mărimile 2µg, 10µg și 1mg, la prețuri între 1.730,30 și 37.800,40 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | FABP5 |
| Applications | SDS-PAGE |
| Reactivity | Human |
| Formulation | Lyophilized from Phosphate Buffered Saline. |
| Product form | Lyophilized |
| Concentration | 500 µg/ml |
| Purification | Two-step procedure using size exclusion chromatography before and after refolding. |
| Purity | >90% as determined by SDS-PAGE. |
| Expression system | Escherichia coli |
| Nature | Recombinant |
| Protein species | Human |
| Reconstitution | Reconstitute with 0.2 ml distilled water and let the lyophilized pellet dissolve completely. |
| Protein Length | Full length protein. |
| Storage | Shipped at ambient temperature. Lyophilized: Store at -20°C. Reconstituted aliquots: Short term (2 weeks) store at 4°C. Long term store at -20°C. Avoid freeze/thaw cycles. |
| Secvență | MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 2µg | A60485-2 · 1.730,30 lei |
| 10µg | A60485-10 · 2.329,25 lei |
| 1mg | A60485-1 · 37.800,40 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/60/A60485.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-human-fabp5-protein/ · actualizat 9 septembrie 2026