# Recombinant Human Estrogen Inducible Protein pS2

**Cod produs:** A61793 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Human Estrogen Inducible Protein pS2 este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A61793, pentru ținta Estrogen Inducible Protein pS2. Se livrează în mărimile 5µg, 20µg și 1mg, la prețuri între 1.730,30 și 24.423,85 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Estrogen Inducible Protein pS2 |
| Applications | SDS-PAGE |
| Formulation | Lyophilized from 20 mM Phosphate Buffered Saline, pH 7.4, with 150 mM Sodium Chloride. |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | >97% as determined by RP-HPLC and SDS-PAGE. |
| Expression system | Escherichia coli |
| Nature | Recombinant |
| Protein species | Human |
| Reconstitution | Reconstitute with 18 MO-cm water, to no less than 0.1 mg/ml, which can then be further diluted to other aqueous solutions. |
| Protein Length | Protein fragment |
| Secvență | EAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEF |
| Activitate biologică | ED50: 100 IU/mg. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 5µg | A61793-5 · 1.730,30 lei |
| 20µg | A61793-20 · 2.329,25 lei |
| 1mg | A61793-1 · 24.423,85 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/61/A61793.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-human-estrogen-inducible-protein-ps2/ · actualizat 9 septembrie 2026
