# Recombinant Human Eotaxin 2 Protein

**Cod produs:** A61247 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Human Eotaxin 2 Protein este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A61247, pentru ținta Eotaxin 2. Se livrează în mărimile 5µg, 20µg și 1mg, la prețuri între 1.730,30 și 24.423,85 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Eotaxin 2 |
| Applications | Chemotaxis |
| Formulation | Lyophilized from 20 mM Phosphate Buffered Saline, pH 7.4, with 150 mM Sodium Chloride. |
| Product form | Lyophilized |
| Concentration | 1 mg/ml |
| Purity | >97% as determined by RP-HPLC and SDS-PAGE. |
| Expression system | Escherichia coli |
| Nature | Recombinant |
| Protein species | Human |
| Reconstitution | Reconstitute with 18 MO-cm water, to no less than 0.1 mg/ml, which can then be further diluted to other aqueous solutions. |
| Protein Length | Protein fragment |
| Secvență | VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKGGVIFTTKKGQQFCGDPKQEWV QRYMKNLDAKQKKASPRARAVA |
| Activitate biologică | The activity is determined by the chemoattract of human PBE (peripheral blood eosinophils) at a concentration between 50-100 ng/ml corresponding to a Specific Activity of 10,000-20,000 IU/mg. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 5µg | A61247-5 · 1.730,30 lei |
| 20µg | A61247-20 · 2.329,25 lei |
| 1mg | A61247-1 · 24.423,85 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/61/A61247.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-human-eotaxin-2-protein/ · actualizat 9 septembrie 2026