# Recombinant Human CXCL2 Protein

**Cod produs:** A330504 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Human CXCL2 Protein este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A330504, pentru ținta CXCL2. Se livrează în mărimea 20µg, la prețul de 1.896,68 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | CXCL2 |
| Conjugate | Unconjugated |
| Formulation | Lyophilized from Phosphate Buffered Saline, pH 7.4 (0.22µm filter sterilized). |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | > 95% (by SDS-PAGE). |
| Expression system | Pichia |
| Nature | Recombinant |
| Protein species | Human |
| Endotoxin level | <0.1 EU/µg. |
| Storage | Shipped at 4°C. Lyophilized: Store at -20°C to -80°C up to 1 year from the date of receipt. Reconstituted: Aliquot and store at -20°C for 3 months or 2-8°C for up to 1 week. Avoid freeze/thaw cycles. |
| Secvență | APLATELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 20µg | A330504-20 · 1.896,68 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/330/A330504.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-human-cxcl2-protein-3/ · actualizat 9 septembrie 2026
