# Recombinant Human CTGF Protein (His Tag)

**Cod produs:** A63073 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Human CTGF Protein (His Tag) este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A63073, pentru ținta CTGF. Se livrează în mărimile 4µg, 20µg și 1mg, la prețuri între 1.730,30 și 21.761,85 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | CTGF |
| Applications | SDS-PAGE |
| Formulation | Lyophilized without additives. |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | >90% as determined by SDS-PAGE. |
| Expression system | Escherichia coli |
| Nature | Recombinant |
| Protein species | Human |
| Reconstitution | Reconstitute with 18 MO-cm water, to no less than 0.1 mg/ml, which can then be further diluted to other aqueous solutions. |
| Protein Length | Protein fragment |
| Secvență | YRLEDTFGPDPTMIRANCLVQTTEWSACSKTCGMGISTRVTNDNASCRLEKQSRLCMVRPCEADLEENI |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 4µg | A63073-4 · 1.730,30 lei |
| 20µg | A63073-20 · 2.329,25 lei |
| 1mg | A63073-1 · 21.761,85 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/63/A63073.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-human-ctgf-protein-his-tag/ · actualizat 9 septembrie 2026