# Recombinant Human CNTF Protein

**Cod produs:** A63579 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Human CNTF Protein este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A63579, pentru ținta CNTF. Se livrează în mărimile 5µg, 20µg și 1mg, la prețuri între 1.730,30 și 24.423,85 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | CNTF |
| Applications | SDS-PAGE |
| Formulation | Lyophilized from 5 mM Phosphate Buffered Saline, pH 7.5, and 5 mM Sodium Chloride. |
| Product form | Lyophilized |
| Concentration | 1 mg/ml |
| Purity | >98% as determined by RP-HPLC and SDS-PAGE. |
| Expression system | Escherichia coli |
| Nature | Recombinant |
| Protein species | Human |
| Reconstitution | Reconstitute with 18 MO-cm water, to no less than 0.1 mg/ml, which can then be further diluted to other aqueous solutions. |
| Protein Length | Full length protein. |
| Secvență | MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM |
| Activitate biologică | ED50: <2 ng/ml, as determined by the dose-dependant stimulation of TF-1 cells, corresponding to a Specific Activity of 500,000 IU/mg. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 5µg | A63579-5 · 1.730,30 lei |
| 20µg | A63579-20 · 2.329,25 lei |
| 1mg | A63579-1 · 24.423,85 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/63/A63579.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-human-cntf-protein/ · actualizat 9 septembrie 2026