# Recombinant Human CEA Protein (C-terminal hFc Tag)

**Cod produs:** A332926 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Human CEA Protein (C-terminal hFc Tag) este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A332926, pentru ținta CEA. Se livrează în mărimile 50µg și 100µg, la prețuri între 5.290,73 și 7.653,25 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | CEA |
| Applications | SDS-PAGE |
| Conjugate | Unconjugated |
| Formulation | Lyophilized from sterile Phosphate Buffered Saline, pH 7.4. Normally 5%–8% Trehalose is added as a protectant before lyophilization. |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Molecular weight | 35-70 kDa due to glycosylation. |
| Purity | >95% as determined by SDS-PAGE and Coomassie blue staining. |
| Expression system | HEK293 cells |
| Nature | Recombinant |
| Protein species | Human |
| Reconstitution | Reconstitute with distilled sterile water. |
| Protein Length | Protein fragment |
| Storage | Shipped at 4°C. Lyophilized: Store at -20°C to -80°C. Reconstituted: Aliquot and store at -80°C. Product is stable for one year. Avoid freeze/thaw cycles. |
| Secvență | VLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAEL |
| Aminoacizi | Val411-Leu500 |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 50µg | A332926-50 · 5.290,73 lei |
| 100µg | A332926-100 · 7.653,25 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/332/A332926.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-human-cea-protein-c-terminal-hfc-tag-6/ · actualizat 9 septembrie 2026
