# Recombinant Human Cdc42 Protein (N-terminal GST Tag)

**Cod produs:** A330433 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Human Cdc42 Protein (N-terminal GST Tag) este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A330433, pentru ținta CDC42. Se livrează în mărimea 100µg, la prețul de 4.891,43 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | CDC42 |
| Conjugate | Unconjugated |
| Formulation | Lyophilized from sterile 20mM Tris, pH 8.0, with 0.15M NaCl and 0.5mM GSH. |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | > 85% by SDS-PAGE. |
| Expression system | Escherichia coli |
| Nature | Recombinant |
| Protein species | Human |
| Storage | Shipped at 4°C. Lyophilized: Store at -20°C to -80°C up to 1 year from the date of receipt. Reconstituted: Aliquot and store at -20°C for 3 months or 2-8°C for up to 1 week. Avoid freeze/thaw cycles. |
| Secvență | MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRC |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µg | A330433-100 · 4.891,43 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/330/A330433.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-human-cdc42-protein-n-terminal-gst-tag/ · actualizat 9 septembrie 2026