# Recombinant Human CD8 alpha Protein (C-terminal Human Fc and His Tag)

**Cod produs:** A330401 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Human CD8 alpha Protein (C-terminal Human Fc and His Tag) este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A330401, pentru ținta CD8 alpha. Se livrează în mărimea 50µg, la prețul de 3.327,50 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | CD8 alpha |
| Conjugate | Unconjugated |
| Formulation | Lyophilized from Phosphate Buffered Saline, pH 7.4 (0.22µm filter sterilized). |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | > 95% (by SDS-PAGE). |
| Expression system | HEK293 cells |
| Nature | Recombinant |
| Protein species | Human |
| Endotoxin level | <0.1 EU/µg of the protein by LAL method. |
| Storage | Shipped at 4°C. Lyophilized: Store at -20°C to -80°C up to 1 year from the date of receipt. Reconstituted: Aliquot and store at -20°C for 3 months or 2-8°C for up to 1 week. Avoid freeze/thaw cycles. |
| Secvență | SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD |
| Activitate biologică | Immobilized Human CD8A (2µg/mL) bind anti Human CD8A antibody in a functional ELISA with a linear range of 0.1-27.6ng/mL. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 50µg | A330401-50 · 3.327,50 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/330/A330401.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-human-cd8-alpha-protein-c-terminal-human-fc-and-his-tag/ · actualizat 9 septembrie 2026