# Recombinant Human CD16 Protein (Biotin) (C-terminal His and Avi Tag)

**Cod produs:** A330239 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Human CD16 Protein (Biotin) (C-terminal His and Avi Tag) este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A330239, pentru ținta CD16. Se livrează în mărimea 100µg, la prețul de 5.590,20 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | CD16 |
| Conjugate | Biotin |
| Formulation | Lyophilized from Phosphate Buffered Saline, pH 7.4, with 8% Trehalose (0.22µm filter sterilized). |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | > 95 % by SDS-PAGE and HPLC |
| Expression system | HEK293 cells |
| Nature | Recombinant |
| Protein species | Human |
| Endotoxin level | <1 EU/µg of the protein by LAL method. |
| Storage | Shipped at 4°C. Lyophilized: Store at -20°C to -80°C up to 1 year from the date of receipt. Reconstituted: Aliquot and store at -20°C for 3 months or 2-8°C for up to 1 week. Avoid freeze/thaw cycles. |
| Secvență | GMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLFGSKNVSSETVNITITQGLAVSTISSFFPPGYQ |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µg | A330239-100 · 5.590,20 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/330/A330239.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-human-cd16-protein-biotin-c-terminal-his-and-avi-tag/ · actualizat 9 septembrie 2026
