# Recombinant Human CD105 Protein

**Cod produs:** A61574 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Human CD105 Protein este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A61574, pentru ținta CD105. Se livrează în mărimile 2µg, 5µg și 10µg, la prețuri între 3.194,40 și 6.222,43 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | CD105 |
| Applications | SDS-PAGE |
| Formulation | Supplied in 50 mM Tris Acetate Buffer, pH 7.5, with 1 mM EDTA and 20% Glycerol. |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purity | >90% as determined by RP-HPLC and SDS-PAGE. |
| Expression system | Escherichia coli |
| Nature | Recombinant |
| Protein species | Human |
| Protein Length | Protein fragment |
| Storage | Shipped at 4°C. Short term (2-4 weeks) store at 4°C. Long term store at -20°C, it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid freeze/thaw cycles. |
| Secvență | ETVHCDLQPVGPERGEVTYTTSQVSKGCVAQAPNAILEVHVLFLEFPTGPSQLELTLQASKQNGTWPREVLLVLSVNSSVFLHLQALGIPLHLAYNSSLVTFQEPPGVNTTELPSFPKTQILEWAAERGPITSAAELNDPQSILLRLGQAQ |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 2µg | A61574-2 · 3.194,40 lei |
| 5µg | A61574-5 · 4.092,83 lei |
| 10µg | A61574-10 · 6.222,43 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/61/A61574.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-human-cd105-protein/ · actualizat 9 septembrie 2026
