# Recombinant Human CCL14 Protein

**Cod produs:** A61304 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Human CCL14 Protein este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A61304, pentru ținta CCL14. Se livrează în mărimile 2µg, 10µg și 1mg, la prețuri între 1.730,30 și 24.423,85 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | CCL14 |
| Applications | Chemotaxis |
| Formulation | Lyophilized from 20 mM Phosphate Buffered Saline, pH 7.4, with 150 mM Sodium Chloride. |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | >97% as determined by RP-HPLC and SDS-PAGE. |
| Expression system | Escherichia coli |
| Nature | Recombinant |
| Protein species | Human |
| Reconstitution | Reconstitute with 18 MO-cm water, to no less than 0.1 mg/ml, which can then be further diluted to other aqueous solutions. |
| Protein Length | Protein fragment |
| Secvență | TESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN |
| Activitate biologică | The biological activity is calculated by its ability to chemoattract Human monocytes at 5-20 ng/ml corresponding to a Specific Activity of 50,000-200,000 IU/mg. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 2µg | A61304-2 · 1.730,30 lei |
| 10µg | A61304-10 · 2.329,25 lei |
| 1mg | A61304-1 · 24.423,85 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/61/A61304.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-human-ccl14-protein-2/ · actualizat 9 septembrie 2026