# Recombinant Human CCL13 Protein

**Cod produs:** A61310 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Human CCL13 Protein este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A61310, pentru ținta CCL13. Se livrează în mărimile 2µg, 10µg și 1mg, la prețuri între 1.464,10 și 24.423,85 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | CCL13 |
| Applications | SDS-PAGE |
| Formulation | Lyophilized from 20 mM Phosphate Buffered Saline, pH 7.4, with 130 mM Sodium Chloride. |
| Product form | Lyophilized |
| Concentration | 1 mg/ml |
| Purity | >96% as determined by RP-HPLC and SDS-PAGE. |
| Expression system | Escherichia coli |
| Nature | Recombinant |
| Protein species | Human |
| Reconstitution | Reconstitute with 18 MO-cm water, to no less than 0.1 mg/ml, which can then be further diluted to other aqueous solutions. |
| Protein Length | Protein fragment |
| Secvență | QPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT |
| Activitate biologică | The specific activity as determined by the ability of MCP-4 to chemoattaract human monocytes at 10-100 ng/ml, corresponding to a Specific Activity of 10,000-100,000 U/mg. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 2µg | A61310-2 · 1.464,10 lei |
| 10µg | A61310-10 · 1.929,95 lei |
| 1mg | A61310-1 · 24.423,85 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/61/A61310.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-human-ccl13-protein/ · actualizat 9 septembrie 2026