# Recombinant Human C5 Protein

**Cod produs:** A330179 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Human C5 Protein este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A330179, pentru ținta C5. Se livrează în mărimea 10µg, la prețul de 1.563,93 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | C5 |
| Conjugate | Unconjugated |
| Formulation | Lyophilized from Phosphate Buffered Saline, pH 7.4 (0.22µm filter sterilized). |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | >94% (by SDS-PAGE). |
| Expression system | Escherichia coli |
| Nature | Recombinant |
| Protein species | Human |
| Endotoxin level | <0.1 EU/ug of the protein by LAL method. |
| Storage | Shipped at 4°C. Lyophilized: Store at -20°C to -80°C up to 1 year from the date of receipt. Reconstituted: Aliquot and store at -20°C for 3 months or 2-8°C for up to 1 week. Avoid freeze/thaw cycles. |
| Secvență | LQKKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQRAARISLGPRCIKAFTECCVVASQLRANISHKDMQLGR |
| Activitate biologică | Ability to induce N-acetyl-ß-D-glucosaminidase release from differentiated U937 human histiocytic lymphoma cells: ED50 = typically 5-15ng/mL. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 10µg | A330179-10 · 1.563,93 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/330/A330179.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-human-c5-protein-2/ · actualizat 9 septembrie 2026