# Recombinant Human c-Jun Protein (N-terminal His Tag)

**Cod produs:** A62615 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Human c-Jun Protein (N-terminal His Tag) este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A62615, pentru ținta c-Jun. Se livrează în mărimile 2µg, 10µg și 1mg, la prețuri între 1.730,30 și 51.210,23 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | c-Jun |
| Applications | WB |
| Formulation | Lyophilized without additives. |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | >95% as determined by SDS-PAGE. |
| Expression system | Escherichia coli |
| Nature | Recombinant |
| Protein species | Human |
| Reconstitution | Centrifuge vial before opening. Reconstitute with 40 mM Tris, pH 7.5, to 0.2-1.0 mg/ml. |
| Protein Length | Protein fragment |
| Storage | Shipped at ambient temperature. Short term (1-2 weeks) store at 4°C. Long term store at -20°C. Avoid freeze/thaw cycles. |
| Secvență | MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLII |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 2µg | A62615-2 · 1.730,30 lei |
| 10µg | A62615-10 · 2.329,25 lei |
| 1mg | A62615-1 · 51.210,23 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/62/A62615.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-human-c-jun-protein-n-terminal-his-tag-2/ · actualizat 9 septembrie 2026