# Recombinant Human BNP Protein (His Tag)

**Cod produs:** A325635 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Human BNP Protein (His Tag) este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A325635, pentru ținta BNP. Se livrează în mărimile 25µg, 50µg și 100µg, la prețuri între 7.453,60 și 18.301,25 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | BNP |
| Applications | SDS-PAGE |
| Formulation | Supplied in 20 mM TRIS-HCl, pH 7.5, with 500 mM Sodium Chloride, 4 mM Caclium Chloride, 4 mM Magneisum Chloride, and 60 mM beta-Mercaptoethanol. |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purity | >90% as determined by SDS-PAGE. |
| Expression system | Escherichia coli |
| Nature | Recombinant |
| Protein species | Human |
| Protein Length | Protein fragment |
| Storage | Shipped at 4°C. Short term (1 week) store at 10°C. Long term store below -18°C. Avoid freeze/thaw cycles. |
| Secvență | MDPQTAPSRALLLLLFLHLAFLGGRSHPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSPKMVQ |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 25µg | A325635-25 · 7.453,60 lei |
| 50µg | A325635-50 · 12.145,38 lei |
| 100µg | A325635-100 · 18.301,25 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/325/A325635.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-human-bnp-protein-his-tag/ · actualizat 9 septembrie 2026