# Recombinant Human BMP7 Protein (N-terminal His Tag)

**Cod produs:** A61415 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Human BMP7 Protein (N-terminal His Tag) este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A61415, pentru ținta BMP7. Se livrează în mărimile 2µg, 10µg și 1mg, la prețuri între 1.730,30 și 60.893,25 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | BMP7 |
| Applications | SDS-PAGE |
| Formulation | Lyophilized from 50 mM Tris HCl Buffer, pH 7.4. |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | >97% as determined by SDS-PAGE. |
| Expression system | Nicotiana benthamiana |
| Nature | Recombinant |
| Protein species | Human |
| Reconstitution | Reconstitute with distilled water to 50 ng/µl. |
| Protein Length | Protein fragment |
| Secvență | HHHHHHSTGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSVILKKYRNMVVRACGCH |
| Activitate biologică | ED50: <40 ng/ml, as determined by its ability to induce alkaline phosphatase production by ATDC5 cells, corresponding to a specific activity of 25,000 U/mg. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 2µg | A61415-2 · 1.730,30 lei |
| 10µg | A61415-10 · 2.329,25 lei |
| 1mg | A61415-1 · 60.893,25 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/61/A61415.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-human-bmp7-protein-n-terminal-his-tag/ · actualizat 9 septembrie 2026