# Recombinant Human Betatrophin Protein (N-terminal Human Fc Tag)

**Cod produs:** A330158 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Human Betatrophin Protein (N-terminal Human Fc Tag) este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A330158, pentru ținta Betatrophin. Se livrează în mărimile 10µg și 50µg, la prețuri între 2.262,70 și 5.324,00 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Betatrophin |
| Conjugate | Unconjugated |
| Formulation | Lyophilized from 20mM PB, pH 7.4, with 150mM NaCl (0.22µm filter sterilized). |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | >80% (by reducing SDS-PAGE). |
| Expression system | HEK293 cells |
| Nature | Recombinant |
| Protein species | Human |
| Endotoxin level | <1 EU/µg. |
| Storage | Shipped at 4°C. Lyophilized: Store at -20°C to -80°C up to 1 year from the date of receipt. Reconstituted: Aliquot and store at -20°C for 3 months or 2-8°C for up to 1 week. Avoid freeze/thaw cycles. |
| Secvență | APMGGPELAQHEELTLLFHGTLQLGQALNGVYRTTEGRLTKARNSLGLYGRTIELLGQEVSRGRDAAQELRASLLETQMEEDILQLQAEATAEVLGEVAQAQKVLRDSVQRLEVQLRSAWLGPAYREFEVLKAHADKQSHILWALTGHVQRQRREMVAQQHRLRQIQERLHTAALPA |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 10µg | A330158-10 · 2.262,70 lei |
| 50µg | A330158-50 · 5.324,00 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/330/A330158.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-human-betatrophin-protein-n-terminal-human-fc-tag/ · actualizat 9 septembrie 2026