# Recombinant Human BCA1 Protein

**Cod produs:** A61317 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Human BCA1 Protein este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A61317, pentru ținta BCA1. Se livrează în mărimile 5µg, 20µg și 1mg, la prețuri între 1.730,30 și 24.423,85 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | BCA1 |
| Applications | Chemotaxis |
| Formulation | Lyophilized from 20 mM Phosphate Buffered Saline, pH 7.4, with 150 mM Sodium Chloride. |
| Product form | Lyophilized |
| Concentration | 500 µg/ml |
| Purity | >97% as determined by RP-HPLC and SDS-PAGE. |
| Expression system | Escherichia coli |
| Nature | Recombinant |
| Protein species | Human |
| Reconstitution | Reconstitute with 18 MO-cm water, to no less than 0.1 mg/ml, which can then be further diluted to other aqueous solutions. |
| Protein Length | Protein fragment |
| Secvență | VLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNG CPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKR SSSTLPVPVFKRKIP |
| Activitate biologică | Determined by its ability to chemoattract human B cells using a concentration range of 1-10 ng/ml corresponding to a Specific Activity of 100,000-1,000,000 IU/mg. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 5µg | A61317-5 · 1.730,30 lei |
| 20µg | A61317-20 · 2.329,25 lei |
| 1mg | A61317-1 · 24.423,85 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/61/A61317.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-human-bca1-protein/ · actualizat 9 septembrie 2026