# Recombinant Human B7-H4 Protein (C-terminal hFc Tag)

**Cod produs:** A332928 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Human B7-H4 Protein (C-terminal hFc Tag) este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A332928, pentru ținta B7-H4. Se livrează în mărimile 50µg și 100µg, la prețuri între 3.593,70 și 5.190,90 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | B7-H4 |
| Applications | SDS-PAGE |
| Conjugate | Unconjugated |
| Formulation | Lyophilized from sterile Phosphate Buffered Saline, pH 7.4. Normally 5%–8% Trehalose is added as a protectant before lyophilization. |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Molecular weight | 35-55 kDa due to glycosylation. |
| Purity | >95% as determined by SDS-PAGE and Coomassie blue staining. |
| Expression system | HEK293 cells |
| Nature | Recombinant |
| Protein species | Human |
| Reconstitution | Reconstitute with distilled sterile water. |
| Protein Length | Protein fragment |
| Storage | Shipped at 4°C. Lyophilized: Store at -20°C to -80°C. Reconstituted: Aliquot and store at -80°C. Product is stable for one year. Avoid freeze/thaw cycles. |
| Secvență | LIIGFGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSM |
| Aminoacizi | Leu25-Met152 |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 50µg | A332928-50 · 3.593,70 lei |
| 100µg | A332928-100 · 5.190,90 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/332/A332928.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-human-b7-h4-protein-c-terminal-hfc-tag/ · actualizat 9 septembrie 2026
