# Recombinant Human Apo-D Protein (GST Tag)

**Cod produs:** A61482 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Human Apo-D Protein (GST Tag) este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A61482, pentru ținta Apo-D. Se livrează în mărimile 2µg, 5µg și 10µg, la prețuri între 3.194,40 și 6.222,43 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Apo-D |
| Formulation | Supplied in 50 mM Tris Acetate Buffer, pH 7.5, with 1 mM EDTA and 20% Glycerol. |
| Product form | Liquid |
| Concentration | Lot Specific |
| Expression system | Escherichia coli |
| Nature | Recombinant |
| Protein species | Human |
| Protein Length | Full length protein. |
| Storage | Shipped at 4°C. Store at -20°C to -80°C, stable for 12 months. |
| Secvență | MVMLLLLLSALAGLFGAAEGQAFHLGKCPNPPVQENFDVNKYLGRWYEIEKIPTTFENGRCIQANYSLMENGKIKVLNQELRADGTVNQIEGEATPVNLTEPAKLEVKFSWFMPSAPYWILATDYENYALVYSCTCIIQLFHVDFAWILARNPNLPPETVDSLKNILTSNNIDVKKMTVTDQVNCPKLS |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 2µg | A61482-2 · 3.194,40 lei |
| 5µg | A61482-5 · 4.092,83 lei |
| 10µg | A61482-10 · 6.222,43 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/61/A61482.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-human-apo-d-protein-gst-tag/ · actualizat 9 septembrie 2026