# Recombinant Human Amphiregulin Protein

**Cod produs:** A330095 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Human Amphiregulin Protein este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A330095, pentru ținta Amphiregulin. Se livrează în mărimile 10µg și 50µg, la prețuri între 1.796,85 și 3.959,73 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Amphiregulin |
| Conjugate | Unconjugated |
| Formulation | Lyophilized from 20mM PB, pH 7.4, with 150mM NaCl and without preservatives or carriers (0.2µm filter sterilized). |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | > 95% (by SDS-PAGE). |
| Expression system | Escherichia coli |
| Nature | Recombinant |
| Protein species | Human |
| Endotoxin level | <1 EU/µg of the protein by LAL method. |
| Storage | Shipped at 4°C. Lyophilized: Store at -20°C to -80°C up to 1 year from the date of receipt. Reconstituted: Aliquot and store at -20°C for 3 months or 2-8°C for up to 1 week. Avoid freeze/thaw cycles. |
| Secvență | SVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGERCGEKSMKTHSMIDSSLSK |
| Activitate biologică | Inhibition of cell proliferation for Balb/3T3 mouse embryonic fibroblast cells: ED50 = 5-15ng/mL. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 10µg | A330095-10 · 1.796,85 lei |
| 50µg | A330095-50 · 3.959,73 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/330/A330095.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-human-amphiregulin-protein-2/ · actualizat 9 septembrie 2026