# Recombinant Human 4-1BBL Protein (C-terminal His Tag)

**Cod produs:** A330055 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Human 4-1BBL Protein (C-terminal His Tag) este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A330055, pentru ținta 4-1BBL. Se livrează în mărimile 20µg și 50µg, la prețuri între 1.896,68 și 2.662,00 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | 4-1BBL |
| Conjugate | Unconjugated |
| Formulation | Lyophilized from 50mM Tris, pH 8.0, with 150mM NaCl and without preservatives or carriers (0.22µm filter sterilized). |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | > 95% (by SDS-PAGE). |
| Expression system | Escherichia coli |
| Nature | Recombinant |
| Protein species | Human |
| Endotoxin level | <0.1 EU/µg of the protein by LAL method. |
| Storage | Shipped at 4°C. Lyophilized: Store at -20°C to -80°C up to 1 year from the date of receipt. Reconstituted: Aliquot and store at -20°C for 3 months or 2-8°C for up to 1 week. Avoid freeze/thaw cycles. |
| Secvență | REGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 20µg | A330055-20 · 1.896,68 lei |
| 50µg | A330055-50 · 2.662,00 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/330/A330055.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-human-4-1bbl-protein-c-terminal-his-tag/ · actualizat 9 septembrie 2026