# Recombinant Horse Serum Amyloid A Protein (A 10 amino acid affinity tag)

**Cod produs:** A325652 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Horse Serum Amyloid A Protein (A 10 amino acid affinity tag) este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A325652, pentru ținta Serum Amyloid A. Se livrează în mărimile 50µg, 100µg și 1mg, la prețuri între 5.057,80 și 43.556,98 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Serum Amyloid A |
| Applications | SDS-PAGE |
| Formulation | Lyophilized from a solution containing 10 mM HCl, pH 2. |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | >95% as determined by SDS-PAGE. |
| Expression system | Escherichia coli |
| Nature | Recombinant |
| Protein species | Horse |
| Reconstitution | Reconstitute with 10 mM HCl, pH 2, to no less than 0.1 mg/ml, which can then be further diluted to other aqueous solutions. |
| Protein Length | Full length protein. |
| Secvență | LLSFLGEAARGTWDMIRAYNDMREANYIGADKYFHARGNYDAAKRGPGGAWAAKVISDARENFQRFTDRFSFGGSGRGAEDSRADQAANEWGRSGKDPNHFRPHGLPDKY |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 50µg | A325652-50 · 5.057,80 lei |
| 100µg | A325652-100 · 7.453,60 lei |
| 1mg | A325652-1 · 43.556,98 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/325/A325652.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-horse-serum-amyloid-a-protein-a-10-amino-acid-affinity-tag/ · actualizat 9 septembrie 2026