# Recombinant HIV Type-O gp41 Protein (N-terminal His Tag)

**Cod produs:** A113214 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant HIV Type-O gp41 Protein (N-terminal His Tag) este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A113214, pentru ținta HIV Type-O gp41. Se livrează în mărimile 100µg, 500µg și 1mg, la prețuri între 2.329,25 și 6.422,08 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | HIV Type-O gp41 |
| Applications | SDS-PAGE |
| Formulation | Lyophilized from a solution containing 20 mM Sodium Carbonate, pH 9.6. |
| Product form | Lyophilized |
| Concentration | 1 mg/ml |
| Purity | >95% as determined by SDS-PAGE. |
| Expression system | Escherichia coli |
| Nature | Recombinant |
| Protein species | HIV1 |
| Reconstitution | Reconstitute with 18 MO-cm water, to no less than 0.1 mg/ml, which can then be further diluted to other aqueous solutions. |
| Storage | Shipped at ambient temperature. Short term (4 weeks) store at 25°C. Long term store below -18°C. Avoid freeze/thaw cycles. |
| Secvență | MGHHHHHHGSVQTHTLLKGIVQQQDNLLRAIQAQQHLLRLSVWGIRQLRARLLALETLI QNQQLLNLWGAKGRLIAYTSVKWNTTWGGGGSIWGNLTWQEWDQQIDNVSSIIYEEIQ KAQDQQEQNEKKLLELDE |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µg | A113214-100 · 2.329,25 lei |
| 500µg | A113214-500 · 4.691,78 lei |
| 1mg | A113214-1 · 6.422,08 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/113/A113214.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-hiv-type-o-gp41-protein-n-terminal-his-tag/ · actualizat 9 septembrie 2026