# Recombinant Hepatitis B Virus Surface Antigen preS2 Protein

**Cod produs:** A58572 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Hepatitis B Virus Surface Antigen preS2 Protein este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A58572, pentru ținta Hepatitis B Virus Surface Antigen preS2. Se livrează în mărimile 10µg, 50µg și 1mg, la prețuri între 1.730,30 și 17.003,53 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Hepatitis B Virus Surface Antigen preS2 |
| Applications | SDS-PAGE |
| Formulation | Lyophilized from 20 mM Phosphate Buffered Saline, pH 7.4, with 50 mM Sodium Chloride. |
| Product form | Lyophilized |
| Concentration | 1 mg/ml |
| Purity | >95% as determined by RP-HPLC and SDS-PAGE. |
| Expression system | Escherichia coli |
| Nature | Recombinant |
| Protein species | Hepatitis B |
| Reconstitution | Centrifuge vial before opening. Reconstitute with sterile distilled water or aqueous buffer containing 0.1% BSA to 0.1-1.0 mg/ml. Further dilutions should be made in appropriate buffered solutions. |
| Secvență | MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASP ISSIFSRTGDPAPN |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 10µg | A58572-10 · 1.730,30 lei |
| 50µg | A58572-50 · 2.329,25 lei |
| 1mg | A58572-1 · 17.003,53 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/58/A58572.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-hepatitis-b-virus-surface-antigen-pres2-protein/ · actualizat 9 septembrie 2026
