# Recombinant Gilthead Seabream IGF1 Protein

**Cod produs:** A63088 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Gilthead Seabream IGF1 Protein este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A63088, pentru ținta IGF1. Se livrează în mărimile 10µg, 50µg și 1mg, la prețuri între 1.730,30 și 19.199,68 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | IGF1 |
| Applications | Binding Assay |
| Formulation | Lyophilized from a solution containing 0.02% Sodium Bicarbonate. |
| Product form | Lyophilized |
| Concentration | 1 mg/ml |
| Purity | >98% as determined by SEC-HPLC and SDS-PAGE. |
| Expression system | Escherichia coli |
| Nature | Recombinant |
| Protein species | Gilthead Seabream |
| Reconstitution | Reconstitute with 0.4% Sodium Bicarbonate adjusted to pH 8-9, to no less than 0.1 mg/ml, which can then be further diluted to other aqueous solutions. |
| Secvență | MSPETLCGAELVDTLQFVCGERGFYFSKPGYGPNARRSRGIVDECCFQSCELRRLEMYCAPAKTSK |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 10µg | A63088-10 · 1.730,30 lei |
| 50µg | A63088-50 · 2.329,25 lei |
| 1mg | A63088-1 · 19.199,68 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/63/A63088.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-gilthead-seabream-igf1-protein/ · actualizat 9 septembrie 2026