# Recombinant E. coli Thioredoxin / TRX Protein

**Cod produs:** A60474 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant E. coli Thioredoxin / TRX Protein este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A60474, pentru ținta Thioredoxin/TRX. Se livrează în mărimile 20µg, 100µg și 1mg, la prețuri între 1.730,30 și 8.984,25 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Thioredoxin/TRX |
| Applications | SDS-PAGE |
| Formulation | Lyophilized from 20 mM Phosphate Buffered Saline, pH 7.4. |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | >90% as determined by RP-HPLC and SDS-PAGE. |
| Expression system | Escherichia coli |
| Nature | Recombinant |
| Protein species | E. coli |
| Reconstitution | Reconstitute with 18 MO-cm water. |
| Storage | Shipped at ambient temperature. Short term (3 weeks) store at 4°C. Long term store desiccated below -18°C. Avoid freeze/thaw cycles. |
| Secvență | HMSDKIIHL TDDSFDTDVLKADGAIL VDFW AEWCGPCKMIAPILDEI GKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGAL DANLA |
| Activitate biologică | TRX activity is assayed by measuring the change in absorbance at 650 nm at 25°C using 0.13 µM bovine insulin containing 0.33mM DTT (pH 6.5).The specific activity was found to be 3 IU/mg. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 20µg | A60474-20 · 1.730,30 lei |
| 100µg | A60474-100 · 2.329,25 lei |
| 1mg | A60474-1 · 8.984,25 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/60/A60474.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-e-coli-thioredoxin-trx-protein/ · actualizat 9 septembrie 2026