# Recombinant Bovine FGF2 Protein

**Cod produs:** A63294 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Bovine FGF2 Protein este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A63294, pentru ținta FGF2. Se livrează în mărimile 10µg, 50µg și 1mg, la prețuri între 1.730,30 și 12.112,10 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | FGF2 |
| Applications | SDS-PAGE |
| Formulation | Lyophilized from a solution containing 1% HSA. |
| Product form | Lyophilized |
| Concentration | 1 mg/ml |
| Purity | >97% as determined by RP-HPLC and SDS-PAGE. |
| Expression system | Escherichia coli |
| Nature | Recombinant |
| Protein species | Bovine |
| Reconstitution | Reconstitute with 18 MO-cm water, to no less than 0.1 mg/ml, which can then be further diluted to other aqueous solutions. |
| Protein Length | Full length protein. |
| Secvență | MAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGPKTGPGQKAILFLPMSAKS |
| Activitate biologică | ED50: <0.1 ng/ml, as determined by a mitogenic assay using quiescent NR6R-3T3 fibroblasts, corresponding to a specific activity of 3 x 106 U/mg. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 10µg | A63294-10 · 1.730,30 lei |
| 50µg | A63294-50 · 2.329,25 lei |
| 1mg | A63294-1 · 12.112,10 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/63/A63294.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-bovine-fgf2-protein/ · actualizat 9 septembrie 2026