# Anti-Wilms Tumor Protein Antibody \[ARC2610\]

**Cod produs:** A308215 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-Wilms Tumor Protein Antibody [ARC2610] este un anticorp monoclonal de iepure împotriva țintei Wilms Tumor Protein, cu reactivitate declarată pentru Human, Mouse, Rat. Este validat pentru WB, IHC, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 3.094,58 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Wilms Tumor Protein |
| Applications | WB, IHC |
| Reactivity | Human, Mouse, Rat |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide. |
| Host | Rabbit |
| Clonality | Monoclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | WB: 1:500-1:1,000, IHC: 1:50-1:200 |
| Molecular weight | 51 - 60 kDa |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Clonă | ARC2610 |
| Secvență | PPPPPPPPPHSFIKQEPSWGGAEPHEEQCLSAFTVHFSGQFTGTAGACRYGPFGPPPPSQASSGQARMFPNAPYLPSCLESQPAIRNQGYSTVTFDGTPSYGHTPSHHAAQFPNHSFKHEDPMGQQGSLGEQQYSVPPPVYGCHTPTDSCTGSQALLLRTPYSSDNLYQMTSQLECMTWNQMNLGATLKGV |
| Imunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 60-250 of human WT1 (P19544). |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A308215-100 · 3.094,58 lei |

## Descriere

Rabbit monoclonal [ARC2610] antibody to Wilms Tumor Protein.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/308/A308215.pdf)

---

Sursă: https://reactivi.ro/produs/anti-wilms-tumor-protein-antibody-arc2610/ · actualizat 9 septembrie 2026