# Anti-Von Willebrand Factor Antibody \[ARC52173\]

**Cod produs:** A306677 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-Von Willebrand Factor Antibody [ARC52173] este un anticorp monoclonal de iepure împotriva țintei Von Willebrand Factor, cu reactivitate declarată pentru Human, Mouse. Este validat pentru IHC, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 3.094,58 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Von Willebrand Factor |
| Applications | IHC |
| Reactivity | Human, Mouse |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.05% Proclin 300. |
| Host | Rabbit |
| Clonality | Monoclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | IHC: 1:500-1:1,000 |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Clonă | ARC52173 |
| Secvență | LPTACTIQLRGGQIMTLKRDETLQDGCDTHFCKVNERGEYFWEKRVTGCPPFDEHKCLAEGGKIMKIPGTCCDTCEEPECNDITARLQYVKVGSCKSEVEVDIHYCQGKCASKAMYSIDINDVQDQCSCCSPTRTEPMQVALHCTNGSVVYHEVLNAMECKCSPRKCSK |
| Imunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 2645-2813 of human von Willebrand factor (VWF) (NP_000543.3). |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A306677-100 · 3.094,58 lei |

## Descriere

Rabbit monoclonal [ARC52173] antibody to Von Willebrand Factor.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/306/A306677.pdf)

---

Sursă: https://reactivi.ro/produs/anti-von-willebrand-factor-antibody-arc52173/ · actualizat 9 septembrie 2026