# Anti-VEGF Receptor 3 Antibody

**Cod produs:** A88139 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-VEGF Receptor 3 Antibody este un anticorp policlonal de iepure împotriva țintei VEGF Receptor 3, cu reactivitate declarată pentru Human. Este validat pentru WB, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 2.662,00 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | VEGF Receptor 3 |
| Applications | WB |
| Reactivity | Human |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal. |
| Host | Rabbit |
| Clonality | Polyclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | WB: 1:500-1:2,000 |
| Molecular weight | 180 kDa |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Secvență | SQVSTMALHIAQADAEDSPPSLQRHSLAARYYNWVSFPGCLARGAETRGSSRMKTFEEFPMTPTTYKGSVDNQTDSGMVLASEEFEQIESRHRQESGFSCK |
| Imunogen | A synthetic peptide corresponding to a sequence within amino acids 1200-1300 of human VEGFR3/FLT4 (NP_891555.2). |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A88139-100 · 2.662,00 lei |

## Descriere

Rabbit polyclonal antibody to VEGF Receptor 3.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/88/A88139.pdf)

---

Sursă: https://reactivi.ro/produs/anti-vegf-receptor-3-antibody-2/ · actualizat 9 septembrie 2026
