# Anti-Tyrosine Hydroxylase Antibody \[ARC1184\]

**Cod produs:** A307645 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-Tyrosine Hydroxylase Antibody [ARC1184] este un anticorp monoclonal de iepure împotriva țintei Tyrosine Hydroxylase, cu reactivitate declarată pentru Human, Mouse, Rat. Este validat pentru WB, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 3.094,58 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Tyrosine Hydroxylase |
| Applications | WB |
| Reactivity | Human, Mouse, Rat |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide. |
| Host | Rabbit |
| Clonality | Monoclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | WB: 1:500-1:2,000 |
| Molecular weight | 59 kDa |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Clonă | ARC1184 |
| Secvență | MPTPDATTPQAKGFRRAVSELDAKQAEAIMVRGQGAPGPSLTGSPWPGTAAPAASYTPTPRSPRFIGRRQSLIEDARKEREAAVAAAAAAVPSEPGDPLE |
| Imunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Tyrosine Hydroxylase (P07101). |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A307645-100 · 3.094,58 lei |

## Descriere

Rabbit monoclonal [ARC1184] antibody to Tyrosine Hydroxylase.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/307/A307645.pdf)

---

Sursă: https://reactivi.ro/produs/anti-tyrosine-hydroxylase-antibody-arc1184/ · actualizat 9 septembrie 2026
